PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g093030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 829aa    MW: 90031.6 Da    PI: 6.7828
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g093030.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.9e-20130185156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++ Le++F+++ +p++++r +L+++l+L+ rqVk+WFqNrR+++k
  Csa05g093030.1 130 KKRYHRHTPKQIQDLESVFKECAHPDEKQRLDLSRRLNLDPRQVKFWFQNRRTQMK 185
                     688999***********************************************999 PP

2START185.43e-583385572206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                     la++a++elvk+a+ ++p+Wv+ss    + +n++e+ ++f++  +     + +ea+++sg v+ ++  lve+l+d+  +W e+++    + +t+e
  Csa05g093030.1 338 LALAAMDELVKMAQTRDPLWVRSSdtgfDVLNREEYDTSFSRCVGpkpdgFVSEASKESGTVIINSLALVETLMDSE-RWAEMFPsmisRTSTTE 431
                     6899********************999988888888888866444888999**************************.*******9999****** PP

                     EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                      issg      gal+lm+aelq+lsplvp R + f+R+++q+ +g+w++vdvS+ds ++ + sss+ R   lpSg+l+++++ng+skvtw+eh++
  Csa05g093030.1 432 IISSGmggtrnGALHLMQAELQLLSPLVPvRQVSFLRFCKQHAEGVWAVVDVSIDSIREGS-SSSCRR---LPSGCLVQDMANGYSKVTWIEHTE 522
                     ************************************************************9.777766...************************ PP

                     --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++ +h l+r+l++ gla+ga +w+a+lqrqce+
  Csa05g093030.1 523 YDENRIHRLYRPLLSCGLAFGAHRWMAALQRQCEC 557
                     *********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.05E-19118187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-20121187IPR009057Homeodomain-like
PROSITE profilePS5007117.07127187IPR001356Homeobox domain
SMARTSM003891.9E-18128191IPR001356Homeobox domain
PfamPF000461.8E-17130185IPR001356Homeobox domain
CDDcd000861.20E-17130187No hitNo description
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PROSITE profilePS5084839.795328560IPR002913START domain
SuperFamilySSF559611.35E-31332557No hitNo description
CDDcd088751.01E-110332556No hitNo description
SMARTSM002342.9E-46337557IPR002913START domain
PfamPF018521.9E-50338557IPR002913START domain
SuperFamilySSF559613.02E-18586820No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 829 aa     Download sequence    Send to blast
MNFNGFLDNT SSGVDGAGAS KLLSDVPYNN NNHHFSFSAV DTMLGTTTAI TTPSLHSRTP  60
NSRPFSSHGL SLGLHTNGEV LMESNVSRKK TSRGGGEDVT TESRSESDNA EALSGDDLDT  120
SDDRPPFKKK KRYHRHTPKQ IQDLESVFKE CAHPDEKQRL DLSRRLNLDP RQVKFWFQNR  180
RTQMKTQIER HENALLRQEN DKLRAENMSV REAMRNPMCG NCGGPAVLAD ISIEEQHLRI  240
ENSRLKDELD RVCALTGKFL GRSNGSHYIP DSALVLGVGV GSAGCNGGVG GGGGFTLSSP  300
RFEISNGTGS GLVTVNHHHQ PPVSSVSDFD HRSRYLDLAL AAMDELVKMA QTRDPLWVRS  360
SDTGFDVLNR EEYDTSFSRC VGPKPDGFVS EASKESGTVI INSLALVETL MDSERWAEMF  420
PSMISRTSTT EIISSGMGGT RNGALHLMQA ELQLLSPLVP VRQVSFLRFC KQHAEGVWAV  480
VDVSIDSIRE GSSSSCRRLP SGCLVQDMAN GYSKVTWIEH TEYDENRIHR LYRPLLSCGL  540
AFGAHRWMAA LQRQCECLTI LMSSTVSPSP SPTPINCNGR KSMLKLAKRM TENFCGGVCA  600
SSLQKWSKLN VGNVDEDVRI MTRKSVNIPG EPPGIVLNAA TSVWMPVSPR RLFDFLGNEG  660
LRSEWDILSN GGPMKEMAHI AKGHDHSNSV SLLRASAVSA NQSSMLILQE TSIDAAGAVV  720
VYAPVDIPAM QAVMNGGDSA YVALLPSGFA ILPNAQAGTQ RCATEEGNGN GNGGMCMEEG  780
GSLLTVAFQI LVNSLPTAKL TVESVETVNN LISCTVQKIK AALHCDSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0508660.0AY050866.1 Arabidopsis thaliana putative homeobox protein (At3g61150) mRNA, complete cds.
GenBankAY0967570.0AY096757.1 Arabidopsis thaliana putative homeobox protein (At3g61150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010512449.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X2
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLR0FNB90.0R0FNB9_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50020900.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1